PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019707
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 283aa    MW: 31423.9 Da    PI: 6.7898
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019707genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-121565148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++ Ede+l+++     g+   +W  Iar  g+ R++k+c++rw +yl
      Lus10019707 15 RGLWSAAEDEKLKKYMSSNTGRrlgCWGEIARNAGLQRCGKSCRLRWINYL 65
                     788**********************************************97 PP

2Myb_DNA-binding40.94.9e-1371115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++ E+ l+++++ +lG++ W+ Ia+++  gRt++++k++w++ 
      Lus10019707  71 RGPFSPYEQYLILHLHSLLGNR-WSQIAARLS-GRTDNEIKNFWNST 115
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3411065IPR017930Myb domain
SuperFamilySSF466899.8E-2413112IPR009057Homeodomain-like
SMARTSM007171.9E-81467IPR001005SANT/Myb domain
PfamPF002491.4E-101565IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-181672IPR009057Homeodomain-like
CDDcd001677.66E-71865No hitNo description
PROSITE profilePS5129422.08266120IPR017930Myb domain
SMARTSM007173.2E-1270118IPR001005SANT/Myb domain
PfamPF002496.9E-1271115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2473120IPR009057Homeodomain-like
CDDcd001672.03E-873116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MSNNDSNTIS SKLRRGLWSA AEDEKLKKYM SSNTGRRLGC WGEIARNAGL QRCGKSCRLR  60
WINYLRPDLK RGPFSPYEQY LILHLHSLLG NRWSQIAARL SGRTDNEIKN FWNSTLKRRM  120
KMTMMPTTTT TNYNEGSTSA ATGGSSISTS LEHHHHHDAI LMEGQCINND VNIPLLNDHQ  180
QGVMMSSNHH AVSSEVGCSG FEFAAASTIT TNTASSFGFH QLNGYIDHHD DPLVVASVLD  240
GGDDGGQIIL SSGGEDDHSK NNNSIVNYDH YCNWDIMEDL FI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-21612018128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592969.13e-61PREDICTED: transcription factor MYB86-like
TrEMBLA0A0B2QHP34e-61A0A0B2QHP3_GLYSO; Transcription factor MYB46
TrEMBLI1LVD94e-61I1LVD9_SOYBN; Uncharacterized protein
STRINGGLYMA12G36630.11e-60(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-51myb domain protein 83